PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G412300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 319aa    MW: 33883.8 Da    PI: 7.9115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G412300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd+ lv +++++G+g+W++++ + g+ R+ k+c++rw +yl
  Sevir.2G412300.1.p 14 KGPWTPEEDLVLVSYIQEHGPGNWRAVPTRTGLMRCSKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding51.32.7e-1667112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Sevir.2G412300.1.p  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.964965IPR017930Myb domain
SuperFamilySSF466891.12E-2911108IPR009057Homeodomain-like
SMARTSM007175.3E-131363IPR001005SANT/Myb domain
PfamPF002496.3E-161461IPR001005SANT/Myb domain
CDDcd001671.53E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.5E-2465116IPR009057Homeodomain-like
SMARTSM007173.2E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129420.60966116IPR017930Myb domain
PfamPF002495.3E-1567112IPR001005SANT/Myb domain
CDDcd001674.28E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MVRPPCCDKE GVKKGPWTPE EDLVLVSYIQ EHGPGNWRAV PTRTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKRKLQSGG  120
EGAAKPPAHR PASSSKGQWE RRLQTDIDMA RRALREALTP LGDLKTQQHD GVDAAGAGTG  180
GGDSPASSSS GASQCSPSAA APGPYVLTTE NISRMLDGWA GGRKVRRGGS AGPGTPGGAE  240
SASTGSSDAS EVSYGGAAVA SAAPATAGTL SEYETKPAVA APQMPLSAIE SWLFDDDSHF  300
HQVQNASLLD VPTMDYPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-27141164105C-Myb DNA-Binding Domain
1msf_C9e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9554750.0EU955475.1 Zea mays clone 1533591 MYB94 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958408.10.0PREDICTED: transcription factor MYB30-like
SwissprotP813928e-97MYB06_ANTMA; Myb-related protein 306
TrEMBLK3ZVC90.0K3ZVC9_SETIT; Uncharacterized protein
STRINGSi030560m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-89myb domain protein 94